DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neurod4 and ato

DIOPT Version :10

Sequence 1:NP_031527.1 Gene:Neurod4 / 11923 MGIID:108055 Length:330 Species:Mus musculus
Sequence 2:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster


Alignment Length:118 Identity:44/118 - (37%)
Similarity:60/118 - (50%) Gaps:32/118 - (27%)


- Green bases have known domain annotations that are detailed below.


Mouse    52 DSIEEDEE----------------------EEED----GDKPKRRGPKKKKMTKARLERFRARRV 90
            ||:|:||:                      |.:|    |...||||.:...:.|      |.||:
  Fly   200 DSVEDDEDLMLFSGGEDFDGNDGSFDLADGENQDAAAGGSGKKRRGKQITPVVK------RKRRL 258

Mouse    91 KANARERTRMHGLNDALDNLRRVMPCYSKTQKLSKIETLRLARNYIWALSEVL 143
            .||||||.||..||.|.|.||:.:||....::|||.|||::|:.||.||.::|
  Fly   259 AANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLL 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neurod4NP_031527.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..80 12/53 (23%)
bHLH_TS_NeuroD4_ATOH3 59..145 CDD:381564 39/111 (35%)
Neuro_bHLH 146..263 CDD:463621
atoNP_731223.1 bHLH_TS_amos_like 250..311 CDD:381558 31/66 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.