DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neurod4 and tap

DIOPT Version :9

Sequence 1:NP_001316418.1 Gene:Neurod4 / 11923 MGIID:108055 Length:330 Species:Mus musculus
Sequence 2:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster


Alignment Length:300 Identity:86/300 - (28%)
Similarity:121/300 - (40%) Gaps:86/300 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse    60 EEEDGDKPKRR-GPKKKKMTKAR-------LERFRARRVKANARERTRMHGLNDALDNLRRVMPC 116
            |:.:..:|||: ...|.::|::|       ::||  ||:|||.|||.|||.|||||:.||..:|.
  Fly   121 EDPNAPRPKRKYAVGKNRVTRSRSPTQVVKIKRF--RRMKANDRERNRMHNLNDALEKLRVTLPS 183

Mouse   117 YSKTQKLSKIETLRLARNYIWALSEVLETGQ------------TLEGKGFVEMLCKGL---SQP- 165
            ..:..||:|||.||.|.|||:||.:|||:|.            ||.|:...:.|...|   .|| 
  Fly   184 LPEETKLTKIEILRFAHNYIFALEQVLESGGSINLDLEKLQNFTLSGERITKELFDALFVNPQPY 248

Mouse   166 -----TSNLVAGCLQLGPQSTLLEKHEEKSSICDSTISVHSFNY--QSPGL-------------- 209
                 ......|...|....|....|.|:......  ..|..:|  |.||.              
  Fly   249 PLFGRMFPYGQGMAPLAQHQTAPASHAEQPPAMGG--FQHGMDYPQQPPGFDFTGSMRFYHQQQQ 311

Mouse   210 -PSPPYGHMETHSLHLKPQPFKSLGDSFGSHPPDCSTPPYEGPLTPPLSISGNFSLKQDGSPDLE 273
             |..|:        ||:|.|.:.      |.|...|...|:       ...|:|    |.:.:|.
  Fly   312 QPHQPH--------HLQPNPQQE------SSPQQFSQEKYD-------LFRGSF----DAAANLH 351

Mouse   274 KSYNFMPHYTSASLSSGHVHSTPFQTGTPRY-DVPVDLSY 312
                      |.:|.||....:.|.:.||.: |.|.|.::
  Fly   352 ----------STNLDSGIHQQSSFYSQTPPWKDYPEDQAH 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neurod4NP_001316418.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..80 6/20 (30%)
HLH 88..144 CDD:238036 33/55 (60%)
Neuro_bHLH 146..263 CDD:289310 29/154 (19%)
tapNP_524124.1 HLH 155..207 CDD:278439 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835503
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.