DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neurod4 and Oli

DIOPT Version :9

Sequence 1:NP_001316418.1 Gene:Neurod4 / 11923 MGIID:108055 Length:330 Species:Mus musculus
Sequence 2:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster


Alignment Length:196 Identity:57/196 - (29%)
Similarity:75/196 - (38%) Gaps:59/196 - (30%)


- Green bases have known domain annotations that are detailed below.


Mouse    36 RRP-GSYGMLGTLTEEHDSIEEDEEEEEDGDKPKRRGPKK------------------------- 74
            |.| ||.|:.|...:   .:...::...|.:||....|:|                         
  Fly    47 RTPLGSVGLGGFYAQ---GMGMSQQPPTDENKPGPSAPEKPLSPTAAAIAAIAISGGTTTVAVSS 108

Mouse    75 -------KKMTKARLERFRARRVKANARERTRMHGLNDALDNLRRVMPCYS---KTQKLSKIETL 129
                   ....|.:..:.:..|:..|||||.|||.||||||.||.|:| |:   ..:|||||.||
  Fly   109 GGASGSGSNSGKQKNRQGKTVRLNINARERRRMHDLNDALDELRSVIP-YAHSPSVRKLSKIATL 172

Mouse   130 RLARNYIWALSEVLETGQTLEGKGFVEMLCKGLSQPTSNLVAGCLQLGP-------QSTLLEKHE 187
            .||:|||......||..:.|            |:...|...|..|.||.       |:.|...|.
  Fly   173 LLAKNYILMQQNALEELRRL------------LAYIQSTTGAAPLDLGAFPAAAKLQALLQGPHN 225

Mouse   188 E 188
            |
  Fly   226 E 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neurod4NP_001316418.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..80 11/76 (14%)
HLH 88..144 CDD:238036 32/58 (55%)
Neuro_bHLH 146..263 CDD:289310 11/50 (22%)
OliNP_001188830.1 HLH 134..188 CDD:197674 32/54 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.