DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neurod4 and Hand

DIOPT Version :9

Sequence 1:NP_001316418.1 Gene:Neurod4 / 11923 MGIID:108055 Length:330 Species:Mus musculus
Sequence 2:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster


Alignment Length:102 Identity:37/102 - (36%)
Similarity:49/102 - (48%) Gaps:6/102 - (5%)


- Green bases have known domain annotations that are detailed below.


Mouse    84 RFRARRVKANARERTRMHGLNDALDNLRRVMPCYSKTQKLSKIETLRLARNYIWALSEVLETGQT 148
            |...:|..||.:||.|...:|:|...||..:|......|||||:||:||..||..|..||:  ..
  Fly    55 RIVKKRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVNVLD--GD 117

Mouse   149 LEGKGFVEMLCKGLSQPTSNLVAGCL----QLGPQST 181
            |:.||......|.:|:...:....||    |..|.||
  Fly   118 LDPKGGFRAELKPVSRKICSEKKHCLKSEIQNVPLST 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neurod4NP_001316418.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..80
HLH 88..144 CDD:238036 24/55 (44%)
Neuro_bHLH 146..263 CDD:289310 11/40 (28%)
HandNP_609370.2 HLH 59..110 CDD:278439 22/50 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.