DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neurod4 and HLH4C

DIOPT Version :9

Sequence 1:NP_001316418.1 Gene:Neurod4 / 11923 MGIID:108055 Length:330 Species:Mus musculus
Sequence 2:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster


Alignment Length:101 Identity:36/101 - (35%)
Similarity:47/101 - (46%) Gaps:20/101 - (19%)


- Green bases have known domain annotations that are detailed below.


Mouse    80 ARLERFRARRV-----KANA-RERTRMHGLNDALDNLRRVMPCYSKTQKLSKIETLRLARNYIWA 138
            :|.||.|.||.     .|:| |||.|:...|.:...||:::|.....:||||||.|:||..||..
  Fly    95 SREERRRRRRATLKYRTAHATRERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIAY 159

Mouse   139 LSEVLETGQTLEGKGFVEMLCKGLSQPTSNLVAGCL 174
            |:.||||. ...|              .|:....||
  Fly   160 LNHVLETPXDSAG--------------ASSFATSCL 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neurod4NP_001316418.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..80 36/101 (36%)
HLH 88..144 CDD:238036 25/61 (41%)
Neuro_bHLH 146..263 CDD:289310 4/29 (14%)
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 23/56 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.