Sequence 1: | NP_033847.1 | Gene: | Neurod6 / 11922 | MGIID: | 106593 | Length: | 337 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001260674.1 | Gene: | dimm / 35404 | FlyBaseID: | FBgn0023091 | Length: | 390 | Species: | Drosophila melanogaster |
Alignment Length: | 206 | Identity: | 61/206 - (29%) |
---|---|---|---|
Similarity: | 80/206 - (38%) | Gaps: | 58/206 - (28%) |
- Green bases have known domain annotations that are detailed below.
Mouse 71 NGLSRRRGLRKKKTTKLRLERVKFRRQEANARERNRMHGLNDALDNLRKVVPCYSKTQKLSKIET 135
Mouse 136 LRLAKNYIWALSEILRIGKRPDLLTFVQN-------LCKGLSQPTTNLVAGCLQLNARSF----- 188
Mouse 189 -LMGQGG---------------EAAHHTRSP--------------------YSTFYPPYHSPELA 217
Mouse 218 TPPGHGTLDNS 228 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Neurod6 | NP_033847.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 28..80 | 4/8 (50%) | |
Nuclear localization signal. /evidence=ECO:0000255 | 80..86 | 1/5 (20%) | |||
bHLH_TS_NeuroD6_ATOH2 | 82..151 | CDD:381565 | 36/68 (53%) | ||
Neuro_bHLH | 153..272 | CDD:372170 | 21/124 (17%) | ||
dimm | NP_001260674.1 | HLH | 154..208 | CDD:238036 | 32/54 (59%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3898 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |