DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atoh1 and net

DIOPT Version :9

Sequence 1:NP_031526.1 Gene:Atoh1 / 11921 MGIID:104654 Length:351 Species:Mus musculus
Sequence 2:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster


Alignment Length:212 Identity:55/212 - (25%)
Similarity:93/212 - (43%) Gaps:26/212 - (12%)


- Green bases have known domain annotations that are detailed below.


Mouse    19 HHRHPQPHHVPPLTPQPPATLQARDLPVYPAELSLLDSTDPRAWLTPTLQGLCTARAAQYLLHSP 83
            |...|.|.|:  ....|..|...|.|..:|.:|      :|.|.:|...|  |..:|      .|
  Fly   153 HEIMPNPAHI--YVRHPGVTTLHRSLAAHPEQL------EPLALVTTKKQ--CVDQA------GP 201

Mouse    84 ELGASEAAAPRDEADSQGELVRRSGCGGLSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSK 148
            ::.|..|.....:..::..|..|:.....|.|.....:.::        .:::.|.:....|...
  Fly   202 KIEAFSALLIGKQPSAKKTLKERTQKESTSSSFLEASLSDE--------DLNKTGLAPISRPHQH 258

Mouse   149 QVN--GVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSEL 211
            |.|  .:.::||:.||||||.|:|.::.|::.||..:|::.:.:||||...|::|..||..||.:
  Fly   259 QRNYKNMTRERRIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYILTLSRM 323

Mouse   212 LQTPNVGEQPPPPTASC 228
            .......:|..|..|:|
  Fly   324 AGEDYSADQSVPSIATC 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atoh1NP_031526.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..39 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..116 4/26 (15%)
HLH 155..213 CDD:238036 24/57 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..278
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..351
netNP_001259789.1 HLH 269..320 CDD:278439 22/50 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5395
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.