DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atoh1 and tx

DIOPT Version :9

Sequence 1:NP_031526.1 Gene:Atoh1 / 11921 MGIID:104654 Length:351 Species:Mus musculus
Sequence 2:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster


Alignment Length:296 Identity:72/296 - (24%)
Similarity:107/296 - (36%) Gaps:84/296 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse    55 DSTDPRAWLTPTLQGLCTARAAQYLLHS--PELGASEAAAPRDEADSQGELVRRSGCGGLSKSPG 117
            ||.|.|...|      .:||..:|.|..  .:.|::|.....:.||.|.||...:.....|:...
  Fly    22 DSKDSRKRKT------ASARGEKYSLRQKRQKRGSNEDGESANLADFQLELDPIAEPASKSRKNA 80

Mouse   118 PVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNV 182
            |.|                   |:.:||.      :.|.||..||||||.||..:|.||:.||:.
  Fly    81 PTK-------------------SKTKAPP------LSKYRRKTANARERTRMREINTAFETLRHC 120

Mouse   183 IP-------SFNNDKKLSKYETLQMAQIYINALSELLQTPN-----VGEQPPPPTASCKNDHHHL 235
            :|       :.|.::||:|..||::|..||..|::.::.|:     :||        |..:..:.
  Fly   121 VPEAIKGEDAANTNEKLTKITTLRLAMKYITMLTDSIRDPSYESEFIGE--------CLEESANR 177

Mouse   236 RTASSYEGGAGASAVAGAQPAPGGGPRPTPPGPCRTRFSG----------------------PAS 278
            ......|....|....         |.|....|.:|:.||                      |.|
  Fly   178 EARVDLEANEEAEVEL---------PVPVAKKPAKTKGSGKKSSAASKRQSQKQAKIVPQIPPIS 233

Mouse   279 SGGYSVQLDALHFPAFEDRALTAMMAQKDLSPSLPG 314
            ||.......::..||....|..:..:....|.|.||
  Fly   234 SGESCYATSSIGSPASSAYASLSSSSNSHSSSSSPG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atoh1NP_031526.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..39
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..116 7/26 (27%)
HLH 155..213 CDD:238036 27/64 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..278 8/55 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..351 4/7 (57%)
txNP_001287543.1 HLH 95..154 CDD:278439 25/58 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.