DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atoh1 and HLH54F

DIOPT Version :10

Sequence 1:NP_031526.1 Gene:Atoh1 / 11921 MGIID:104654 Length:351 Species:Mus musculus
Sequence 2:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster


Alignment Length:107 Identity:37/107 - (34%)
Similarity:58/107 - (54%) Gaps:10/107 - (9%)


- Green bases have known domain annotations that are detailed below.


Mouse   157 RRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPNVGEQP 221
            :|.|||||||.||..|:.|:.:|:..:|:...|.||||.:||::|.:||..|...::|.:..:..
  Fly    32 QRNAANARERMRMRVLSSAYGRLKTKLPNIPPDTKLSKLDTLRLATLYIKQLITAVETGSHSQNH 96

Mouse   222 PPPTASCKNDHH---HLRTASSYEGGAGASAVAGAQPAPGGG 260
            |    ...|.||   |..::::...|...|.:|.:.   |||
  Fly    97 P----HNHNQHHSLNHSHSSTTSSEGLDTSHMADSS---GGG 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atoh1NP_031526.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..39
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..116
bHLH_TS_ATOH1 152..215 CDD:381556 25/57 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..278 6/17 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..351
HLH54FNP_477302.1 bHLH_TS_musculin_like 32..87 CDD:381429 25/54 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.