Sequence 1: | NP_031526.1 | Gene: | Atoh1 / 11921 | MGIID: | 104654 | Length: | 351 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_477446.1 | Gene: | amos / 35110 | FlyBaseID: | FBgn0003270 | Length: | 198 | Species: | Drosophila melanogaster |
Alignment Length: | 208 | Identity: | 72/208 - (34%) |
---|---|---|---|
Similarity: | 95/208 - (45%) | Gaps: | 47/208 - (22%) |
- Green bases have known domain annotations that are detailed below.
Mouse 27 HVPPLTPQPPA-----TLQARDLPVYPAELSLLDSTDPRA--------WLTPT---LQGLCTAR- 74
Mouse 75 AAQYLLHSPELGASEAAAPRDEADSQGELVRRSGCGGLSKSPGPVKVREQLCKLKGGVVVDELGC 139
Mouse 140 SRQRAPSSKQVNG-----VQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQ 199
Mouse 200 MAQIYINALSELL 212 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Atoh1 | NP_031526.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 16..39 | 3/16 (19%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 89..116 | 6/26 (23%) | |||
HLH | 155..213 | CDD:238036 | 41/58 (71%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 244..278 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 308..351 | ||||
amos | NP_477446.1 | HLH | 137..195 | CDD:238036 | 41/58 (71%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167835486 | |
Domainoid | 1 | 1.000 | 79 | 1.000 | Domainoid score | I8704 |
eggNOG | 1 | 0.900 | - | - | E1_KOG4395 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | oto93063 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | LDO | PTHR19290 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2611 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.870 |