DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atoh1 and amos

DIOPT Version :10

Sequence 1:NP_031526.1 Gene:Atoh1 / 11921 MGIID:104654 Length:351 Species:Mus musculus
Sequence 2:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster


Alignment Length:208 Identity:72/208 - (34%)
Similarity:95/208 - (45%) Gaps:47/208 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse    27 HVPPLTPQPPA-----TLQARDLPVYPAELSLLDSTDPRA--------WLTPT---LQGLCTAR- 74
            :.|...|..|.     |.|..:..:|..|.|..||....|        :.||:   |:.:..|: 
  Fly    12 YFPDEAPAIPEFLSNDTFQQLEQLMYQQEFSTSDSQSDGANSCSLEMYYDTPSVLELEHMLNAQE 76

Mouse    75 AAQYLLHSPELGASEAAAPRDEADSQGELVRRSGCGGLSKSPGPVKVREQLCKLKGGVVVDELGC 139
            ..|:.|.:..||.::..:||.....|    |......||.|                     :..
  Fly    77 QQQHHLQANPLGKNQGRSPRYWNKQQ----RSKPYDKLSTS---------------------MSS 116

Mouse   140 SRQRAPSSKQVNG-----VQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQ 199
            |...|.||...:.     |.|:|||||||||||||:.||.|||:||:|:||..:|::||||||||
  Fly   117 STSSASSSSSSSAGFGGEVLKKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQ 181

Mouse   200 MAQIYINALSELL 212
            |||.||..|..||
  Fly   182 MAQAYIGDLVTLL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atoh1NP_031526.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..39 3/16 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..116 6/26 (23%)
bHLH_TS_ATOH1 152..215 CDD:381556 42/66 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..278
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..351
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 42/63 (67%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.