DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atoh1 and amos

DIOPT Version :9

Sequence 1:NP_031526.1 Gene:Atoh1 / 11921 MGIID:104654 Length:351 Species:Mus musculus
Sequence 2:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster


Alignment Length:208 Identity:72/208 - (34%)
Similarity:95/208 - (45%) Gaps:47/208 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse    27 HVPPLTPQPPA-----TLQARDLPVYPAELSLLDSTDPRA--------WLTPT---LQGLCTAR- 74
            :.|...|..|.     |.|..:..:|..|.|..||....|        :.||:   |:.:..|: 
  Fly    12 YFPDEAPAIPEFLSNDTFQQLEQLMYQQEFSTSDSQSDGANSCSLEMYYDTPSVLELEHMLNAQE 76

Mouse    75 AAQYLLHSPELGASEAAAPRDEADSQGELVRRSGCGGLSKSPGPVKVREQLCKLKGGVVVDELGC 139
            ..|:.|.:..||.::..:||.....|    |......||.|                     :..
  Fly    77 QQQHHLQANPLGKNQGRSPRYWNKQQ----RSKPYDKLSTS---------------------MSS 116

Mouse   140 SRQRAPSSKQVNG-----VQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQ 199
            |...|.||...:.     |.|:|||||||||||||:.||.|||:||:|:||..:|::||||||||
  Fly   117 STSSASSSSSSSAGFGGEVLKKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQ 181

Mouse   200 MAQIYINALSELL 212
            |||.||..|..||
  Fly   182 MAQAYIGDLVTLL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atoh1NP_031526.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..39 3/16 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..116 6/26 (23%)
HLH 155..213 CDD:238036 41/58 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..278
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..351
amosNP_477446.1 HLH 137..195 CDD:238036 41/58 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835486
Domainoid 1 1.000 79 1.000 Domainoid score I8704
eggNOG 1 0.900 - - E1_KOG4395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto93063
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR19290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.