DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atoh1 and Hand

DIOPT Version :10

Sequence 1:NP_031526.1 Gene:Atoh1 / 11921 MGIID:104654 Length:351 Species:Mus musculus
Sequence 2:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster


Alignment Length:88 Identity:34/88 - (38%)
Similarity:47/88 - (53%) Gaps:6/88 - (6%)


- Green bases have known domain annotations that are detailed below.


Mouse   156 QRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQ---TPNV 217
            ::|..||.:||||...:|:||..||..||:...|.||||.:||::|.:|||.|..:|.   .|..
  Fly    58 KKRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVNVLDGDLDPKG 122

Mouse   218 G---EQPPPPTASCKNDHHHLRT 237
            |   |..|.....|....|.|::
  Fly   123 GFRAELKPVSRKICSEKKHCLKS 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atoh1NP_031526.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..39
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..116
bHLH_TS_ATOH1 152..215 CDD:381556 27/61 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..278
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..351
HandNP_609370.2 bHLH_TS_HAND 59..114 CDD:381472 26/54 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.