DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atoh1 and CG33557

DIOPT Version :10

Sequence 1:NP_031526.1 Gene:Atoh1 / 11921 MGIID:104654 Length:351 Species:Mus musculus
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:128 Identity:40/128 - (31%)
Similarity:56/128 - (43%) Gaps:36/128 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse    87 ASEAAAPRDEADSQGELVRRSGCGGLSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVN 151
            ||.:.|..|..|||           :.:...|           ||  .:..|..|:|.|..|   
  Fly    28 ASGSGAAADSEDSQ-----------IGQEANP-----------GG--QENQGNHRRRPPRQK--- 65

Mouse   152 GVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQT 214
                     .|||||.|...:|.|::.|||:||:...::||||.|.:::|..||..||..|:|
  Fly    66 ---------INARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTLET 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atoh1NP_031526.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..39
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..116 5/26 (19%)
bHLH_TS_ATOH1 152..215 CDD:381556 25/63 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..278
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..351
CG33557NP_001014730.1 bHLH_TS_scleraxis_like 63..117 CDD:381471 24/65 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.