DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLIC1 and GstD4

DIOPT Version :10

Sequence 1:NP_001279.2 Gene:CLIC1 / 1192 HGNCID:2062 Length:241 Species:Homo sapiens
Sequence 2:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster


Alignment Length:106 Identity:26/106 - (24%)
Similarity:47/106 - (44%) Gaps:26/106 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   109 DIFAK-FSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNE 172
            |.|.| :..:|:.......:|.:| :..|.:.||.:|               ||   :.::.|::
  Fly   106 DSFMKYYYPFIRTGQLGNAENYKK-VEAAFEFLDIFL---------------EG---QDYVAGSQ 151

Human   173 LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNA 213
            ||:||..:|..:...:||     .|.|.: :..|.|:.:||
  Fly   152 LTVADIAILSSVSTFEVV-----EFDISK-YPNVARWYANA 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLIC1NP_001279.2 Required for insertion into the membrane 2..90
O-ClC 6..241 CDD:129941 26/106 (25%)
G-site. /evidence=ECO:0000305|PubMed:25581026 24..27
GstD4NP_524913.1 GST_N_Delta_Epsilon 1..74 CDD:239343
GST_C_Delta_Epsilon 88..204 CDD:198287 26/106 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.