DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLIC1 and GstO1

DIOPT Version :10

Sequence 1:NP_001279.2 Gene:CLIC1 / 1192 HGNCID:2062 Length:241 Species:Homo sapiens
Sequence 2:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster


Alignment Length:231 Identity:40/231 - (17%)
Similarity:74/231 - (32%) Gaps:89/231 - (38%)


- Green bases have known domain annotations that are detailed below.


Human    24 CPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFL----LYGTEVHTDTNKIEEFL 84
            ||::.|:.:||..|.:.::...::.:.:.|....:....::|.|    ..|..|..::..|.::|
  Fly    30 CPYAHRVHLVLDAKKIPYHAIYINLRDKPEWFSLVSSSTKVPALELVKEQGNPVLIESLIICDYL 94

Human    85 EAVLCP--PRYPK-------------------------LAALNPE-----SNTAGLDIF-----A 112
            :... |  |.|||                         |...|||     .:.|||.::     .
  Fly    95 DEKY-PEVPLYPKDLLKKAQEKILIERFGQFINAFYYLLLHDNPEQLVDTDHYAGLVVYEEELKR 158

Human   113 KFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVD----------ETSAED-------- 159
            :.:.:....:|.:.|               |:..|..|..|          |.|.|.        
  Fly   159 RCTKFFGGDSPGMLD---------------YMMWPWCERFDSLKYTFEQKFELSPERFPTLIKWR 208

Human   160 --------------EGVSQRKFLDGNELTLADCNLL 181
                          :|.:..|:::......||.|:|
  Fly   209 DLMIQDRAVKCFYLDGQTHAKYMNSRRSGQADYNML 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLIC1NP_001279.2 Required for insertion into the membrane 2..90 13/69 (19%)
O-ClC 6..241 CDD:129941 40/231 (17%)
G-site. /evidence=ECO:0000305|PubMed:25581026 24..27 2/2 (100%)
GstO1NP_648237.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 3..95 CDD:469754 12/64 (19%)
GST_C_Omega 109..234 CDD:198293 18/139 (13%)

Return to query results.
Submit another query.