DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLIC1 and GstO3

DIOPT Version :10

Sequence 1:NP_001279.2 Gene:CLIC1 / 1192 HGNCID:2062 Length:241 Species:Homo sapiens
Sequence 2:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster


Alignment Length:190 Identity:40/190 - (21%)
Similarity:75/190 - (39%) Gaps:43/190 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    24 CPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVL 88
            ||::||..:||..|.|.::...::...:.|.:.::.|..::|.|....| ..:.:.||..:.|..
  Fly    30 CPYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPLLKVPALQLVAE-KGEPSLIESLIIAEY 93

Human    89 CPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPAL-NDNLEKGLLKALKVLDNYLTSP-LPEE 151
            ...:||:                          ||.| .|.|::...|.|....:.:||. :...
  Fly    94 LDDKYPE--------------------------NPLLPKDPLKRAQDKILLERFSSITSAFINIL 132

Human   152 VDETSAED---------EGVSQR--KFLDGNELTLADCNLLP---KLHIVQVVCKKYRGF 197
            |..|..||         |.:::|  .:..||:....|..:.|   :|.::::..:|...|
  Fly   133 VQGTGLEDYWTALDIFEEELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNF 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLIC1NP_001279.2 Required for insertion into the membrane 2..90 16/65 (25%)
O-ClC 6..241 CDD:129941 40/190 (21%)
G-site. /evidence=ECO:0000305|PubMed:25581026 24..27 2/2 (100%)
GstO3NP_648234.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 3..95 CDD:469754 16/65 (25%)
GST_C_Omega 109..230 CDD:198293 18/84 (21%)

Return to query results.
Submit another query.