DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLIC1 and GstE3

DIOPT Version :10

Sequence 1:NP_001279.2 Gene:CLIC1 / 1192 HGNCID:2062 Length:241 Species:Homo sapiens
Sequence 2:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster


Alignment Length:176 Identity:41/176 - (23%)
Similarity:59/176 - (33%) Gaps:45/176 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    79 KIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPAL------NDNLEKGLLKAL 137
            ||...:|.....|.:.|   :||......||....:.|.....|..|      ||:|....||..
  Fly    32 KIVNLMEKEHLKPEFLK---INPLHTVPALDDNGFYLADSHAINSYLVSKYGRNDSLYPKDLKKR 93

Human   138 KVLDNYL--------------TSPL----PEEVDETSAED-EGV--------SQRKFLDGNELTL 175
            .::|..|              |.||    ..|:.:...:. |||        ....:|.|:.||:
  Fly    94 AIVDQRLHYDSSVVTSTGRAITFPLFWENKTEIPQARIDALEGVYKSLNLFLENGNYLAGDNLTI 158

Human   176 ADCNLLPKLH----IVQVVCKKYRGFTIPEAFRGVHRYLSNAYARE 217
            ||.:::..|.    .:.|...||     ||....:.|.....|..|
  Fly   159 ADFHVIAGLTGFFVFLPVDATKY-----PELAAWIKRIKELPYYEE 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLIC1NP_001279.2 Required for insertion into the membrane 2..90 3/10 (30%)
O-ClC 6..241 CDD:129941 41/176 (23%)
G-site. /evidence=ECO:0000305|PubMed:25581026 24..27
GstE3NP_611325.2 GstA 4..200 CDD:440390 41/176 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.