DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLIC1 and GstE9

DIOPT Version :10

Sequence 1:NP_001279.2 Gene:CLIC1 / 1192 HGNCID:2062 Length:241 Species:Homo sapiens
Sequence 2:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster


Alignment Length:171 Identity:36/171 - (21%)
Similarity:57/171 - (33%) Gaps:42/171 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    62 GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRY------------PKLAALNPESNTAGLDIFAKF 114
            |:|  :|||.|........:..|:|:.....|            .:.:..||:.....|:...||
  Fly     2 GKL--VLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKF 64

Human   115 -------SAYIKNSNPALNDNLEKGLLK-ALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGN 171
                   .||:.......:|...|...| ||              ||:....:.||..:..:...
  Fly    65 IWESHAICAYLVRRYAKSDDLYPKDYFKRAL--------------VDQRLHFESGVLFQGCIRNI 115

Human   172 ELTLADCNL--LPKLHIVQVVCKKYRGFTIPEAFRGVHRYL 210
            .:.|...|:  :|:..|..:    |..:...|||.|...||
  Fly   116 AIPLFYKNITEVPRSQIDAI----YEAYDFLEAFIGNQAYL 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLIC1NP_001279.2 Required for insertion into the membrane 2..90 8/27 (30%)
O-ClC 6..241 CDD:129941 36/171 (21%)
G-site. /evidence=ECO:0000305|PubMed:25581026 24..27
GstE9NP_725784.1 GstA 4..199 CDD:440390 35/169 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.