DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf3 and kay

DIOPT Version :9

Sequence 1:NP_031524.2 Gene:Atf3 / 11910 MGIID:109384 Length:181 Species:Mus musculus
Sequence 2:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster


Alignment Length:161 Identity:45/161 - (27%)
Similarity:70/161 - (43%) Gaps:45/161 - (27%)


- Green bases have known domain annotations that are detailed below.


Mouse     7 GQVSASEVSATAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVN--- 68
            |.:.|..|:...:            .:|:|:...|...            |.|:::.|...|   
  Fly   356 GHIMAGSVNGGGV------------NNFSNVLAAVSSS------------RGSASVGSSNANTSN 396

Mouse    69 -----------NRPLEMSVTKSEAAPEEDERKRRRRERNKIAAAKCRNKKKEKTECLQKESEKLE 122
                       ||...|:       |||::::..||||||.|||:||.::.::|..|.:|.|:||
  Fly   397 TPARRGGGRRPNRSTNMT-------PEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLE 454

Mouse   123 SVNAELKAQIEELKNEKQHLIYMLNLHRPTC 153
            .....::.:||.|.|.|..|.|:|..||.||
  Fly   455 KRGESMRKEIEVLTNSKNQLEYLLATHRATC 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf3NP_031524.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..97 8/23 (35%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 88..110 11/21 (52%)
bZIP_ATF3 96..149 CDD:269870 21/52 (40%)
coiled coil 96..146 CDD:269870 20/49 (41%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 114..142 10/27 (37%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 25/60 (42%)
coiled coil 421..480 CDD:269869 25/58 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.