DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf2 and kay

DIOPT Version :9

Sequence 1:NP_001020264.1 Gene:Atf2 / 11909 MGIID:109349 Length:487 Species:Mus musculus
Sequence 2:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster


Alignment Length:426 Identity:96/426 - (22%)
Similarity:150/426 - (35%) Gaps:109/426 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse   142 TSAIVRPASLQVPNVLLTSSD------SSVIIQQAVPSPTSSTVI-----TQAPSSNRPIVPVPG 195
            |||.....:....|..:.:|:      :.:.:||.....|..:|:     |..|::.|.|....|
  Fly   201 TSAAAGSDNNHSDNFAMDASEIATFLANELFLQQLGNFETGQSVLTLTTPTLTPTTTRNIEDTLG 265

Mouse   196 PFPLLLHLPNGQTMPVAIPASITSSNVHVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRL 260
            ..     |.:.||..||..|..         |||.|.|..:.....|||...|..|:|....:.|
  Fly   266 HL-----LSDTQTDRVAGCAGF---------AVPKVLPNAIDVLGMGIPTGVSSLPLQQTFDLSL 316

Mouse   261 KAALTQQHPPVTNGDTVKGHGSGLVRTQSEESRPQSLQQ--------------------PATSTT 305
            ......:....:..||..........|.|..:...|.|.                    .|.|::
  Fly   317 GQGSESEDSNASYNDTQMNEEQDTTDTSSAHTDSTSYQAGHIMAGSVNGGGVNNFSNVLAAVSSS 381

Mouse   306 ETPASPAHTTPQTQNTSGRR------RRAANEDPDEKRRKFL--ERNRAAASRCRQKRKVWVQSL 362
            ...||...:...|.||..||      .|:.|..|:|::::.:  |||:.||:|||::|......|
  Fly   382 RGSASVGSSNANTSNTPARRGGGRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNEL 446

Mouse   363 EKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPVTAMQKKS---------------GYH 412
            .::.|.|......::.|:.:|.|...||:.||..|:   .|..:.:|               |..
  Fly   447 TEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLATHR---ATCQKIRSDMLSVVTCNGLIAPAGLL 508

Mouse   413 TADKDDSSEDLSVPSSPHTEAIQHSSVSTSNG--------VSSTS--------KAEAVATSVLTQ 461
            :|....|.     .||.|    .|:|..:|||        ::||.        |..|...|:|..
  Fly   509 SAGSSGSG-----ASSHH----NHNSNDSSNGTITGMDATLNSTGRSNSPLDLKPAANIDSLLMH 564

Mouse   462 MADQSTEPAL-------------SQIVMAPPSQAQP 484
            :.|:..:.|:             |:.:..||....|
  Fly   565 IKDEPLDGAIDSGSSLDQDGPPPSKRITLPPMSTMP 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf2NP_001020264.1 C2H2 Zn finger 9..31 CDD:275370
GCN4_cent 47..84 CDD:213399
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 106..137
PRK14951 <184..>312 CDD:237865 32/147 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 241..355 34/141 (24%)
Essential for its histone acetyltransferase activity. /evidence=ECO:0000250 278..281 0/2 (0%)
bZIP_ATF2 336..396 CDD:269835 19/61 (31%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 336..356 8/21 (38%)
coiled coil 337..388 CDD:269835 15/52 (29%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 362..390 6/27 (22%)
Nuclear export signal. /evidence=ECO:0000250 387..396 4/8 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 407..453 15/76 (20%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 19/60 (32%)
coiled coil 421..480 CDD:269869 19/58 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.