DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf1 and kay

DIOPT Version :9

Sequence 1:NP_031523.3 Gene:Atf1 / 11908 MGIID:1298366 Length:269 Species:Mus musculus
Sequence 2:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster


Alignment Length:313 Identity:59/313 - (18%)
Similarity:116/313 - (37%) Gaps:76/313 - (24%)


- Green bases have known domain annotations that are detailed below.


Mouse     7 SNTTETASQPGSTVAGPHVSQIVHQVSSLSESEESQDSSDSIGSSQKAHGIL-----ARRPSYRK 66
            ::||.|::..||.  ..|........|.::....::.....:|:.:....:|     ...|:..:
  Fly   196 TSTTATSAAAGSD--NNHSDNFAMDASEIATFLANELFLQQLGNFETGQSVLTLTTPTLTPTTTR 258

Mouse    67 --------ILKDLSSEDTRGRKGEGEN---PSISAITSMSVPA-----PIYQT---SSGQYIAIA 112
                    :|.|..::...|..|....   |:...:..|.:|.     |:.||   |.||     
  Fly   259 NIEDTLGHLLSDTQTDRVAGCAGFAVPKVLPNAIDVLGMGIPTGVSSLPLQQTFDLSLGQ----- 318

Mouse   113 PNGALQLASPSTDGVQALQTLTM-------------TNSSSTQQGTILQYAQTSDGQQILVPSNQ 164
                   .|.|.|...:.....|             |:|:|.|.|.|:  |.:.:|..:...|| 
  Fly   319 -------GSESEDSNASYNDTQMNEEQDTTDTSSAHTDSTSYQAGHIM--AGSVNGGGVNNFSN- 373

Mouse   165 VVVQTASGDMQTYQIRTTPSATSLPQTVVMTSPVTLAS------QTTKTDDPQLRREIRLMKNRE 223
             |:...|....:..:.::.:.||       .:|.....      .|..|.:.:.:|.:|..:|::
  Fly   374 -VLAAVSSSRGSASVGSSNANTS-------NTPARRGGGRRPNRSTNMTPEEEQKRAVRRERNKQ 430

Mouse   224 AARECRRKKKEYVKCLENRVAVLENQNKTLIEELKTLKD--------LYSHKS 268
            ||..||:::.:....|...|..||.:.:::.:|::.|.:        |.:|::
  Fly   431 AAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLATHRA 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf1NP_031523.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90 15/98 (15%)
pKID 48..82 CDD:366954 6/46 (13%)
bZIP_CREB1 213..267 CDD:269838 14/61 (23%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 213..237 7/23 (30%)
coiled coil 214..266 CDD:269838 14/59 (24%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 239..260 5/20 (25%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 14/60 (23%)
coiled coil 421..480 CDD:269869 14/58 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.