DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpinc1 and Spn42Dd

DIOPT Version :9

Sequence 1:NP_543120.1 Gene:Serpinc1 / 11905 MGIID:88095 Length:465 Species:Mus musculus
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:395 Identity:133/395 - (33%)
Similarity:205/395 - (51%) Gaps:43/395 - (10%)


- Green bases have known domain annotations that are detailed below.


Mouse    81 VWELSKANSRFATNFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLKQLMEVFKFDTIS 145
            :|..|.| .:.:...||.|:.| :.|.|:.:||:||.|..:|..:||...|.|:|.......  |
  Fly     8 LWVTSVA-CQTSKEIYQLLSKS-HTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLP--S 68

Mouse   146 EKTSDQIHFFFAKLNCRLYRKANKSSDLVSANRLFGDKSLTFNESYQDVSEVVYGAKLQPLDFKE 210
            |........:.|.||.  .:...:...|..|||::.:...:.|::|.......:.::.:.:....
  Fly    69 EDKEAVAARYGALLND--LQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTN 131

Mouse   211 NPEQSRVTINNWVANKTEGRIKDVIPQGAINELTALVLVNTIYFKGLWKSKFSPENTRKEPFYKV 275
            .|..:. .||.||.::|.|:||.:|..|::......:|||.|||||.|:|||.|..||...|...
  Fly   132 GPVAAE-RINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVT 195

Mouse   276 DGQSCPVPMMYQEGKFK--YRRVAEGTQVLELPFKGDDITMVLILPKPEKSLAKVEQELT----P 334
            ..:|.||.||.|.|.|:  |.|..: .||:|||:...:::|.:.||:..:.|:.:|:::.    |
  Fly   196 ANKSVPVQMMAQMGTFRANYFRDLD-AQVIELPYLNSNLSMTIFLPREVEGLSALEEKIVGFARP 259

Mouse   335 ELLQEWLDELSETMLVVHMPRFRTEDGFSLKEQLQDMGLIDLFSPEKSQLPGIVA---GGRDDLY 396
            .:.:|         :.:.:|:|:.|....|||.|:.:|:.:||: :||.|.|:.|   ||:    
  Fly   260 LVAKE---------VYLKLPKFKIEFRDELKETLEKLGIRELFT-DKSDLSGLFADKSGGK---- 310

Mouse   397 VSDAFHKAFLEVNEEGSEAAASTSVVITGRSLNPNRVTFK----ANRPFLVLIREVALNTIIFMG 457
            ||...|||||||||||:|||.:|||.:|      ||..|.    |:.||..:||:.  |||.|.|
  Fly   311 VSQVSHKAFLEVNEEGAEAAGATSVAVT------NRAGFSTFLMADHPFAFVIRDA--NTIYFQG 367

Mouse   458 RVANP 462
            ||.:|
  Fly   368 RVVSP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpinc1NP_543120.1 serpinC1_AT3 71..464 CDD:381002 133/395 (34%)
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 127/381 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.