DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4a and Arf79F

DIOPT Version :9

Sequence 1:NP_001034604.1 Gene:Arl4a / 11861 MGIID:99437 Length:200 Species:Mus musculus
Sequence 2:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster


Alignment Length:186 Identity:80/186 - (43%)
Similarity:118/186 - (63%) Gaps:9/186 - (4%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MGNGLSDQTSILSSLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGN 65
            |||..:   ::...|...:...|:::|||.|||||:||:|:..|.|.|:||.|||.|.::.    
  Fly     1 MGNVFA---NLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY---- 58

Mouse    66 SKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVL 130
             |.::|..||||||:|:||||:.|.:.|.|::|||||.|.||:.||:.||.::....|.:...:|
  Fly    59 -KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLL 122

Mouse   131 IVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMI 186
            |.||||||.|:::.:||...|.:..|.:.. |::|.|||..||||.|||:.|.:.:
  Fly   123 IFANKQDLPNAMNAAEITDKLGLHSLRNRN-WYIQATCATSGDGLYEGLDWLSNQL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4aNP_001034604.1 Arl4_Arl7 18..200 CDD:206719 76/169 (45%)
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 77/182 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.