DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phox2a and PHDP

DIOPT Version :9

Sequence 1:NP_032913.1 Gene:Phox2a / 11859 MGIID:106633 Length:280 Species:Mus musculus
Sequence 2:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster


Alignment Length:177 Identity:73/177 - (41%)
Similarity:95/177 - (53%) Gaps:28/177 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MDYSYLN--SYD-SCVAAMEASAYGDFGACSQPGGFQYS--------PLRPAFPAAGPPCPALGS 54
            |::|.||  ::| .|:....:..|.. ||  ..||...:        .:..::..........||
  Fly     1 MEFSLLNKANFDKDCLYTANSEFYNS-GA--NGGGLSVANHINHYNLMIDSSYKLCANESAIRGS 62

Mouse    55 SN-------CALGALRDHQPAPYSAVPY-------KFFPEPSGLHEKRKQRRIRTTFTSAQLKEL 105
            .|       ..:..:.:..||.::...|       .:..:...|.:|.|||||||||||.||.||
  Fly    63 LNQESSLLFSKITTVSEFYPATHNIGSYNTDFHLKSYGDDGLSLTDKSKQRRIRTTFTSNQLNEL 127

Mouse   106 ERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAA 152
            |::|.||||||||||||:|.|:.||||||||||||||||||||||.|
  Fly   128 EKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRAKFRKQERHA 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phox2aNP_032913.1 Homeobox 94..147 CDD:395001 43/52 (83%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..244 7/8 (88%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..280
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 42/51 (82%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6832
eggNOG 1 0.900 - - E1_KOG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1505098at2759
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - otm42785
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3133
SonicParanoid 1 1.000 - - X2223
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.810

Return to query results.
Submit another query.