DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnd2 and Rac1

DIOPT Version :9

Sequence 1:NP_033838.1 Gene:Rnd2 / 11858 MGIID:1338755 Length:227 Species:Mus musculus
Sequence 2:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster


Alignment Length:169 Identity:75/169 - (44%)
Similarity:114/169 - (67%) Gaps:1/169 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse     9 KIVVVGDAECGKTALLQVFAKDAYPGSYVPTVFENYTASFEIDKRRIELNMWDTSGSSYYDNVRP 73
            |.|||||...|||.||..:..:|:||.|:||||:||:|:..:|.:.|.|.:|||:|...||.:||
  Fly     5 KCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLRP 69

Mouse    74 LAYPDSDAVLICFDISRPETLDSVLKKWQGETQEFCPNAKVVLVGCKLDMRTDLATLRELSKQRL 138
            |:||.:|..||||.:..|.:.::|..||..|.:..||:..::|||.|||:|.|..|:.:|..::|
  Fly    70 LSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLRDKKL 134

Mouse   139 IPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDVFHVA 177
            .|:|:.||..:||::|||.|:|||: .:::.::.||..|
  Fly   135 APITYPQGLAMAKEIGAVKYLECSA-LTQKGLKTVFDEA 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnd2NP_033838.1 Rnd2_Rho7 7..227 CDD:206736 75/169 (44%)
Effector region. /evidence=ECO:0000255 36..44 5/7 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..227
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 75/169 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.