DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arhgdib and RhoGDI

DIOPT Version :9

Sequence 1:NP_001288230.1 Gene:Arhgdib / 11857 MGIID:101940 Length:200 Species:Mus musculus
Sequence 2:NP_001262080.1 Gene:RhoGDI / 40179 FlyBaseID:FBgn0036921 Length:201 Species:Drosophila melanogaster


Alignment Length:202 Identity:97/202 - (48%)
Similarity:131/202 - (64%) Gaps:6/202 - (2%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MTEKDAQPQLEEADDDLDSKLNYKPPPQKSLKELQEMDKDDESLTKYKKTLLGDV---PVVADPT 62
            |.|.:.:...|..|||:.. .||:.||:|:::|:...|::||||.:||:.|||..   .::.:|.
  Fly     1 MAETETKHHPEHHDDDVHD-ANYQAPPEKTIEEIMAADQEDESLRRYKEALLGAAQTEKIIVEPN 64

Mouse    63 VP-NVTVTRLSLVCDSAPGPITMDLTGDLEALKKDTFVLKEGIEYRVKINFKVNKDIVSGLKYVQ 126
            .| .|.|.:|:||.:.. ..:.:||||||..|||..||:|||::|:|:|:|.|.::||.||||||
  Fly    65 DPRKVIVKKLALVVEGR-DDMELDLTGDLSQLKKQLFVIKEGVQYKVRIDFIVQREIVHGLKYVQ 128

Mouse   127 HTYRTGMRVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLTWEWN 191
            .|.|.|:.|||...|||||.|:.|...:|||.||||.|..:||||...|.||||||..||.|:|.
  Fly   129 KTSRLGVNVDKMKHMVGSYPPKKEIQFYLTPAEEAPSGTFSRGTYSVSSVFTDDDKHIHLEWDWT 193

Mouse   192 LAIKKDW 198
            ..|||||
  Fly   194 FEIKKDW 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArhgdibNP_001288230.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39 12/37 (32%)
Rho_GDI 7..197 CDD:366924 92/193 (48%)
RhoGDINP_001262080.1 Rho_GDI 14..199 CDD:280310 91/186 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837037
Domainoid 1 1.000 195 1.000 Domainoid score I3138
eggNOG 1 0.900 - - E1_KOG3205
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 199 1.000 Inparanoid score I3780
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54245
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001289
OrthoInspector 1 1.000 - - otm42349
orthoMCL 1 0.900 - - OOG6_102354
Panther 1 1.100 - - LDO PTHR10980
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2126
SonicParanoid 1 1.000 - - X792
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.