DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rhod and Rac1

DIOPT Version :9

Sequence 1:NP_031511.1 Gene:Rhod / 11854 MGIID:108446 Length:210 Species:Mus musculus
Sequence 2:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster


Alignment Length:175 Identity:91/175 - (52%)
Similarity:120/175 - (68%) Gaps:0/175 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse    17 SVKVVLVGDGGCGKTSLMMVFAKGAFPESYSPTVFERYNATLQMKGKPVHLQIWDTAGQDDYDRL 81
            ::|.|:||||..|||.|::.:...|||..|.||||:.|:|.:.:..||::|.:||||||:|||||
  Fly     3 AIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRL 67

Mouse    82 RPLFYPDANVLLLCFDVTNPNSFDNVSNRWYPEVTHFCKGVPIIVVGCKIDLRKDKVLVNNLRKK 146
            |||.||..:|.|:||.:.||.||:||..:|||||.|.|...|||:||.|:|||.||..:..||.|
  Fly    68 RPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLRDK 132

Mouse   147 RLEPVTYHRGHDMARSVGAVAYLECSARLHDNVEAVFQEAAEVAL 191
            :|.|:||.:|..||:.:|||.||||||.....::.||.||....|
  Fly   133 KLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhodNP_031511.1 Rho4_like 17..208 CDD:206704 91/175 (52%)
RHO 20..192 CDD:197554 90/172 (52%)
Effector region. /evidence=ECO:0000255 46..54 5/7 (71%)
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 90/172 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.