DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rhoc and Rac1

DIOPT Version :9

Sequence 1:NP_001278788.1 Gene:Rhoc / 11853 MGIID:106028 Length:193 Species:Mus musculus
Sequence 2:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster


Alignment Length:194 Identity:107/194 - (55%)
Similarity:136/194 - (70%) Gaps:3/194 - (1%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQED 65
            |.||  |.|:|||||.|||||||.::.:.||..|:||||:||.|::.||.|.:.|.|||||||||
  Fly     1 MQAI--KCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQED 63

Mouse    66 YDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRE 130
            ||||||||||.|||.|:|||:.:|.|.||:..||.|||:|.||:.||||||.|.|||.|::|..:
  Fly    64 YDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEK 128

Mouse   131 LAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGL-QVRKNKRRRGCPIL 193
            |...|..|:...:|..||..|.|..||||||.|::|::.||:.|.|:.| .|.:.|.:|.|.:|
  Fly   129 LRDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPVLQPKSKRKCALL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhocNP_001278788.1 RhoA_like 5..179 CDD:206662 98/173 (57%)
Effector region. /evidence=ECO:0000255 34..42 5/7 (71%)
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 100/174 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.