DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf6 and Arf102F

DIOPT Version :9

Sequence 1:NP_031507.1 Gene:Arf6 / 11845 MGIID:99435 Length:175 Species:Mus musculus
Sequence 2:NP_001259087.1 Gene:Arf102F / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster


Alignment Length:171 Identity:113/171 - (66%)
Similarity:144/171 - (84%) Gaps:0/171 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVG 65
            :..:|:::||.|:|||||:|||||||||||||||||:.||||||:|||||||.|||:.|.|||||
  Fly     5 ISSLLTRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVG 69

Mouse    66 GQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAM 130
            ||||||||||||:..|||||||||..|||||.||.:||..::.:.|:|||::|:||||||||:||
  Fly    70 GQDKIRPLWRHYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDLPNAM 134

Mouse   131 KPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTS 171
            ...|:.:||.|.::|:|:|::|.:|||.|.||||||.||::
  Fly   135 TAAELTDKLRLNQLRNRHWFIQSTCATQGHGLYEGLDWLSA 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf6NP_031507.1 ARF 1..175 CDD:128474 113/171 (66%)
Arf102FNP_001259087.1 YlqF_related_GTPase 1..180 CDD:424112 113/171 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1362554at2759
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.