DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf4 and Arf4

DIOPT Version :10

Sequence 1:NP_031505.1 Gene:Arf4 / 11843 MGIID:99433 Length:180 Species:Mus musculus
Sequence 2:NP_524631.1 Gene:Arf4 / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster


Alignment Length:180 Identity:153/180 - (85%)
Similarity:164/180 - (91%) Gaps:0/180 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTV 65
            ||||||||.:|||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MGLTISSLLTRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTV 65

Mouse    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEGAAVLQKMLLEDELQDAVLLLFANKQDL 130
            ||||||||||||||||||||||||||||||||:||.|....||.||.||||:|||||:|||||||
  Fly    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDL 130

Mouse   131 PNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR 180
            ||||..:|:||||.|..||||.|::|:||||||.||||||||||.||:|:
  Fly   131 PNAMTAAELTDKLRLNQLRNRHWFIQSTCATQGHGLYEGLDWLSAELAKK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf4NP_031505.1 P-loop containing Nucleoside Triphosphate Hydrolases 1..180 CDD:476819 152/178 (85%)
Arf4NP_524631.1 P-loop containing Nucleoside Triphosphate Hydrolases 1..180 CDD:476819 152/178 (85%)

Return to query results.
Submit another query.