DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf1 and Arf79F

DIOPT Version :9

Sequence 1:NP_001123880.1 Gene:Arf1 / 11840 MGIID:99431 Length:181 Species:Mus musculus
Sequence 2:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster


Alignment Length:179 Identity:173/179 - (96%)
Similarity:178/179 - (99%) Gaps:0/179 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTV 65
            |||:|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTV 65

Mouse    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDL 130
            ||||||||||||||||||||||||||||||||||:.|||||||||||||||||||||:|||||||
  Fly    66 WDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDL 130

Mouse   131 PNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRN 179
            |||||||||||||||||||:|||||||||||||||||||||||||||:|
  Fly   131 PNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQLKN 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf1NP_001123880.1 ARF 5..179 CDD:128474 169/173 (98%)
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 169/173 (98%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834071
Domainoid 1 1.000 341 1.000 Domainoid score I1085
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H133930
Inparanoid 1 1.050 357 1.000 Inparanoid score I2218
Isobase 1 0.950 - 0 Normalized mean entropy S16
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1362554at2759
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 1 1.000 - - otm42467
orthoMCL 1 0.900 - - OOG6_100600
Panther 1 1.100 - - LDO PTHR11711
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2403
SonicParanoid 1 1.000 - - X414
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1615.790

Return to query results.
Submit another query.