Sequence 1: | NP_001263613.1 | Gene: | Arc / 11838 | MGIID: | 88067 | Length: | 396 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_610955.1 | Gene: | Arc1 / 36595 | FlyBaseID: | FBgn0033926 | Length: | 254 | Species: | Drosophila melanogaster |
Alignment Length: | 212 | Identity: | 49/212 - (23%) |
---|---|---|---|
Similarity: | 82/212 - (38%) | Gaps: | 35/212 - (16%) |
- Green bases have known domain annotations that are detailed below.
Mouse 186 QESVEAQQYQSWGPGEDGQPSPGVD-----------TQIFEDPR------EFLSHLEEYLRQVGG 233
Mouse 234 SEEYWLSQIQNHMNGPAKKWWEFKQGSVKNWVE----FKKEFLQYSEGTLSREAIQRELEL---P 291
Mouse 292 QKQGEPLDQFLWRKRDLYQTLYVDAEEEEI-IQYVVGTLQPKLKRFLRHPLPKTLEQLIQRGMEV 355
Mouse 356 ----QDGLEQAAEPSGT 368 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Arc | NP_001263613.1 | Interaction with SH3GL1 or SH3GL3. /evidence=ECO:0000250|UniProtKB:Q63053 | 89..100 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 177..207 | 4/20 (20%) | |||
Interaction with DNM2. /evidence=ECO:0000250|UniProtKB:Q63053 | 195..214 | 4/29 (14%) | |||
Arc_C | 278..360 | CDD:375599 | 20/89 (22%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 356..396 | 5/13 (38%) | |||
Arc1 | NP_610955.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |