DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ap3s2 and AP-1sigma

DIOPT Version :9

Sequence 1:NP_033812.3 Gene:Ap3s2 / 11778 MGIID:1337060 Length:193 Species:Mus musculus
Sequence 2:NP_001247273.1 Gene:AP-1sigma / 42835 FlyBaseID:FBgn0039132 Length:157 Species:Drosophila melanogaster


Alignment Length:151 Identity:55/151 - (36%)
Similarity:100/151 - (66%) Gaps:6/151 - (3%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIY 65
            |:..:|:|:..||.||.::|..:|::::::|.||....:|.|...:|:|||      ..|.|::|
  Fly     1 MMLFMLLFSRQGKLRLQKWYMAYPDKVKKKITRELVTTILARKPKMCSFLE------WKDCKIVY 59

Mouse    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVL 130
            :.||:|||...::.:::||..|::|..:||.|||.|.:|||||:||:.:|.::||.|:::||.:.
  Fly    60 KRYASLYFCCAIEQNDNELLTLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDELLIGGEIQ 124

Mouse   131 ETNMNEIVAQIEAQNRLEKSE 151
            ||:...::..|.:|:.|::.|
  Fly   125 ETSKKNVLKAIASQDLLQEDE 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ap3s2NP_033812.3 AP3_sigma 1..146 CDD:341438 53/144 (37%)
AP-1sigmaNP_001247273.1 AP1_sigma 4..145 CDD:341435 53/146 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.