DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TWIST2 and ato

DIOPT Version :10

Sequence 1:NP_476527.1 Gene:TWIST2 / 117581 HGNCID:20670 Length:160 Species:Homo sapiens
Sequence 2:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster


Alignment Length:75 Identity:31/75 - (41%)
Similarity:50/75 - (66%) Gaps:6/75 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    49 KRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDK-LSKIQTLKLAAR 112
            :|||:.:|..:     :.:|:.||.|||:|.|:||:||..||:.:|.|.:|: |||.:||::|..
  Fly   243 RRGKQITPVVK-----RKRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQT 302

Human   113 YIDFLYQVLQ 122
            ||..|..:|:
  Fly   303 YISALGDLLR 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TWIST2NP_476527.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63 4/13 (31%)
bHLH_TS_TWIST2 51..132 CDD:381543 30/73 (41%)
atoNP_731223.1 bHLH_TS_amos_like 250..311 CDD:381558 27/65 (42%)

Return to query results.
Submit another query.