DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TWIST2 and dimm

DIOPT Version :10

Sequence 1:NP_476527.1 Gene:TWIST2 / 117581 HGNCID:20670 Length:160 Species:Homo sapiens
Sequence 2:NP_523611.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster


Alignment Length:89 Identity:35/89 - (39%)
Similarity:55/89 - (61%) Gaps:7/89 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    36 SKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSD- 99
            |..|:.:|:   ..|.:||:.:|   :|...:|:.:|.|||.|..|||:||.:||::||.:..: 
  Fly   132 SNSSNANGN---ASRRRKGALNA---KERNMRRLESNERERMRMHSLNDAFQSLREVIPHVEMER 190

Human   100 KLSKIQTLKLAARYIDFLYQVLQS 123
            :||||:||.||..||..|..::.|
  Fly   191 RLSKIETLTLAKNYIINLTHIILS 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TWIST2NP_476527.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63 7/26 (27%)
bHLH_TS_TWIST2 51..132 CDD:381543 31/74 (42%)
dimmNP_523611.1 bHLH_TS_dimmed_like 157..216 CDD:381555 27/58 (47%)

Return to query results.
Submit another query.