DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TWIST2 and CG33557

DIOPT Version :9

Sequence 1:NP_001258822.1 Gene:TWIST2 / 117581 HGNCID:20670 Length:160 Species:Homo sapiens
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:111 Identity:35/111 - (31%)
Similarity:54/111 - (48%) Gaps:17/111 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    40 SEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSD-KLSK 103
            |||..  .|:....|....|.....:..|...|.|||.||.::|.|:.|||.:|||.|.: ||||
  Fly    37 SEDSQ--IGQEANPGGQENQGNHRRRPPRQKINARERYRTFNVNSAYEALRNLIPTEPMNRKLSK 99

Human   104 IQTLKLAARYIDFLYQVL--------------QSDEMDNKMTSCSY 135
            |:.::||:.||..|...|              :|:.:..:::.|::
  Fly   100 IEIIRLASSYITHLSSTLETGTECQPCLLHKYESEGITRRISICTF 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TWIST2NP_001258822.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63 6/22 (27%)
bHLH_TS_TWIST2 51..132 CDD:381543 30/95 (32%)
CG33557NP_001014730.1 HLH 67..119 CDD:197674 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149592
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.