DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TWIST2 and HLH3B

DIOPT Version :10

Sequence 1:NP_476527.1 Gene:TWIST2 / 117581 HGNCID:20670 Length:160 Species:Homo sapiens
Sequence 2:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster


Alignment Length:118 Identity:38/118 - (32%)
Similarity:58/118 - (49%) Gaps:21/118 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    36 SKKSSEDGSPTPGKRGKKGSPSAQSFEELQS----QRILANVRERQRTQSLNEAFAALRKIIPTL 96
            |..||..||...|..|..|:.|:.....:.:    :::..|.|||.|.|:::.|||.|||::||.
  Fly   131 SSGSSVGGSGGGGGNGSGGNASSGGGSGVGATGGVRKVFTNTRERWRQQNVSGAFAELRKLVPTH 195

Human    97 PSD-KLSKIQTLKLAARYIDFLYQVL----------------QSDEMDNKMTS 132
            |.| ||||.:.|:.|.:||..|..:|                :.:..||:|.:
  Fly   196 PPDKKLSKNEILRSAIKYIKLLTGILEWQQRQAPSHPIRAQMEPNNNDNRMAN 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TWIST2NP_476527.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63 9/26 (35%)
bHLH_TS_TWIST2 51..132 CDD:381543 32/101 (32%)
HLH3BNP_525055.1 bHLH_TS_dHLH3B_like 166..225 CDD:381551 26/58 (45%)

Return to query results.
Submit another query.