DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prdx6 and Jafrac1

DIOPT Version :9

Sequence 1:NP_031479.1 Gene:Prdx6 / 11758 MGIID:894320 Length:224 Species:Mus musculus
Sequence 2:NP_001285202.1 Gene:Jafrac1 / 53578 FlyBaseID:FBgn0040309 Length:194 Species:Drosophila melanogaster


Alignment Length:191 Identity:61/191 - (31%)
Similarity:91/191 - (47%) Gaps:15/191 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse    11 APNFEANTTIG----RIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIAL 71
            ||.|.....:.    .|:..|:.| .:.:||.:|.|||.||.||:...::.|.||.|.|.::|..
  Fly     8 APAFAGTAVVNGVFKDIKLSDYKG-KYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIGC 71

Mouse    72 SIDSVEDHLAWSKDINAYNGETPTEKLPFPIIDDKGRDLAILLGMLDPVEKDANNMPVTARVVFI 136
            |.||...||||   ||....:.....:..|::.||...:|...|:||    :...:|.  |.:||
  Fly    72 STDSQFTHLAW---INTPRKQGGLGSMDIPLLADKSMKVARDYGVLD----EETGIPF--RGLFI 127

Mouse   137 FGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTGTKPVATPVDWKKGESVMVV-PTLSEE 196
            ....:.|:...:.....||:.:|.||:|.:.|.|.......|.:||.|:..||. ||.|:|
  Fly   128 IDDKQNLRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKE 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prdx6NP_031479.1 PRX_1cys 7..222 CDD:239314 61/191 (32%)
Required and sufficient for targeting to lysosomes and lamellar bodies. /evidence=ECO:0000250|UniProtKB:O35244 31..40 2/8 (25%)
Jafrac1NP_001285202.1 PRX_Typ2cys 4..175 CDD:239313 54/176 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.