DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prdx6 and Jafrac2

DIOPT Version :9

Sequence 1:NP_031479.1 Gene:Prdx6 / 11758 MGIID:894320 Length:224 Species:Mus musculus
Sequence 2:NP_001261350.1 Gene:Jafrac2 / 53577 FlyBaseID:FBgn0040308 Length:242 Species:Drosophila melanogaster


Alignment Length:207 Identity:58/207 - (28%)
Similarity:90/207 - (43%) Gaps:25/207 - (12%)


- Green bases have known domain annotations that are detailed below.


Mouse     6 LLGDEAPNFE----ANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNV 66
            ::...||.||    .|..|.::....:|| .:.:|..:|.|||.||.||:...:....||.|...
  Fly    51 VISKPAPQFEGTAVVNKEIVKLSLSQYLG-KYVVLLFYPLDFTFVCPTEIIAFSDRIAEFKKIKT 114

Mouse    67 KLIALSIDSVEDHLAWSKDINAYNGETPTEKLPFPIIDDK----GRDLAILLGMLDPVEKDANNM 127
            ::|.:|:||...||||   ||....|.....:..|::.|.    .:|..:.|      |...:.:
  Fly   115 EVIGVSVDSHFTHLAW---INTPRKEGGLGDVKIPLLSDLTHKISKDYGVYL------ESSGHAL 170

Mouse   128 PVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTGTKPVATPVDWKKGESVMVVPT 192
                |.:||......|:...:.....||:.||.:|:|.:.|.|.|.....|..|:.|... :|| 
  Fly   171 ----RGLFIIDQTGVLRQITMNDLPVGRSVDETIRLVQAFQYTDTHGEVCPAGWRPGADT-IVP- 229

Mouse   193 LSEEEAKQCFPK 204
             :.||..:.|.|
  Fly   230 -NPEEKTKYFAK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prdx6NP_031479.1 PRX_1cys 7..222 CDD:239314 58/206 (28%)
Required and sufficient for targeting to lysosomes and lamellar bodies. /evidence=ECO:0000250|UniProtKB:O35244 31..40 1/8 (13%)
Jafrac2NP_001261350.1 PRX_Typ2cys 52..223 CDD:239313 51/184 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.