DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prdx3 and Jafrac1

DIOPT Version :9

Sequence 1:NP_031478.1 Gene:Prdx3 / 11757 MGIID:88034 Length:257 Species:Mus musculus
Sequence 2:NP_001285202.1 Gene:Jafrac1 / 53578 FlyBaseID:FBgn0040309 Length:194 Species:Drosophila melanogaster


Alignment Length:190 Identity:124/190 - (65%)
Similarity:149/190 - (78%) Gaps:0/190 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse    64 PAVTQHAPYFKGTAVVNGEFKELSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNC 128
            |.:.:.||.|.|||||||.||::.|.|:||||||||||||||||||||||:|||:.|.||..:||
  Fly     2 PQLQKPAPAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINC 66

Mouse   129 EVVAVSVDSHFSHLAWINTPRKNGGLGHMNITLLSDITKQISRDYGVLLESAGIALRGLFIIDPN 193
            ||:..|.||.|:||||||||||.||||.|:|.||:|.:.:::||||||.|..||..|||||||..
  Fly    67 EVIGCSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDK 131

Mouse   194 GVVKHLSVNDLPVGRSVEETLRLVKAFQFVETHGEVCPANWTPESPTIKPSPTASKEYFE 253
            ..::.::|||||||||||||||||:|||:.:.:||||||||.|...|:...||.||||||
  Fly   132 QNLRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYFE 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prdx3NP_031478.1 PRX_Typ2cys 66..236 CDD:239313 113/169 (67%)
PTZ00253 70..252 CDD:140280 120/181 (66%)
Jafrac1NP_001285202.1 PRX_Typ2cys 4..175 CDD:239313 113/170 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X272
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.