DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prdx3 and Jafrac2

DIOPT Version :9

Sequence 1:NP_031478.1 Gene:Prdx3 / 11757 MGIID:88034 Length:257 Species:Mus musculus
Sequence 2:NP_001261350.1 Gene:Jafrac2 / 53577 FlyBaseID:FBgn0040308 Length:242 Species:Drosophila melanogaster


Alignment Length:194 Identity:125/194 - (64%)
Similarity:155/194 - (79%) Gaps:1/194 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse    62 HTPAV-TQHAPYFKGTAVVNGEFKELSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKANEFHD 125
            :|.|| ::.||.|:||||||.|..:|||..:.|||:||.||||||||||||||:||||:..||..
  Fly    47 YTKAVISKPAPQFEGTAVVNKEIVKLSLSQYLGKYVVLLFYPLDFTFVCPTEIIAFSDRIAEFKK 111

Mouse   126 VNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNITLLSDITKQISRDYGVLLESAGIALRGLFII 190
            :..||:.|||||||:||||||||||.||||.:.|.||||:|.:||:||||.|||:|.||||||||
  Fly   112 IKTEVIGVSVDSHFTHLAWINTPRKEGGLGDVKIPLLSDLTHKISKDYGVYLESSGHALRGLFII 176

Mouse   191 DPNGVVKHLSVNDLPVGRSVEETLRLVKAFQFVETHGEVCPANWTPESPTIKPSPTASKEYFEK 254
            |..||::.:::|||||||||:||:|||:|||:.:||||||||.|.|.:.||.|:|....:||.|
  Fly   177 DQTGVLRQITMNDLPVGRSVDETIRLVQAFQYTDTHGEVCPAGWRPGADTIVPNPEEKTKYFAK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prdx3NP_031478.1 PRX_Typ2cys 66..236 CDD:239313 115/170 (68%)
PTZ00253 70..252 CDD:140280 119/181 (66%)
Jafrac2NP_001261350.1 PRX_Typ2cys 52..223 CDD:239313 114/170 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X272
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.