DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prdx3 and Prx2540-2

DIOPT Version :9

Sequence 1:NP_031478.1 Gene:Prdx3 / 11757 MGIID:88034 Length:257 Species:Mus musculus
Sequence 2:NP_523683.1 Gene:Prx2540-2 / 36098 FlyBaseID:FBgn0033518 Length:220 Species:Drosophila melanogaster


Alignment Length:211 Identity:63/211 - (29%)
Similarity:98/211 - (46%) Gaps:33/211 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse    68 QHAPYFKGTAVVNGEFKELSLDDFKG-KYLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVV 131
            |..|.|:.. ...|..|   ..:::| .::|||.:|.|||.||.||:...:....||...|.:.:
  Fly     5 QTVPNFEAD-TTKGPIK---FHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTKCL 65

Mouse   132 AVSVDSHFSHLAWIN--------TPRKNGGLGHMNITLLSDITKQISRDYGVLLE------SAGI 182
            |.|||:..||:.|:|        .|      |.....:::|.|:.::...|:|.|      ..|.
  Fly    66 AHSVDALNSHVDWVNDIKSYCLDIP------GDFPYPIIADPTRDLAVSLGMLDEEQKKDPEVGK 124

Mouse   183 ALRGLFIIDPNGVVKHLSVNDLPVGRSVEETLRLVKAFQFVETHGEVC-PANWTPESPT-IKPSP 245
            .:|.||||.|:..|:......:..||:|:|.||.:.:.|..:....|. ||||||.:.. |.|:.
  Fly   125 TIRALFIISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMILPTV 189

Mouse   246 TASKEY------FEKV 255
            |..:.:      |:||
  Fly   190 TDEEAHKLFPKGFDKV 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prdx3NP_031478.1 PRX_Typ2cys 66..236 CDD:239313 55/183 (30%)
PTZ00253 70..252 CDD:140280 59/204 (29%)
Prx2540-2NP_523683.1 AhpC 1..194 CDD:223527 60/198 (30%)
PRX_1cys 3..218 CDD:239314 63/211 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.