DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sv2a and CG33233

DIOPT Version :9

Sequence 1:NP_476558.2 Gene:Sv2a / 117559 RGDID:619715 Length:742 Species:Rattus norvegicus
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:604 Identity:119/604 - (19%)
Similarity:217/604 - (35%) Gaps:138/604 - (22%)


- Green bases have known domain annotations that are detailed below.


  Rat   149 AQQYETILRECGHGRFQWTLYFVLGLALMADGVEVFVVGF--VLPSAEKDMCLSDSNKGMLGLIV 211
            |...:|.|...|:|..|..::.|.....|....|....|:  ||.|.|.|  .|...|.:|...:
  Fly     3 AMDVDTALLTIGYGLGQVIIFMVSFFIYMYSVTESMTAGYLVVLTSCEFD--TSPKEKTLLANSL 65

  Rat   212 YLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIV 276
            ..||:......|.||||.||:..:.::|.....|:..|:.:....:....|::.|..:.....:.
  Fly    66 LGGMVASGLFIGFLADRYGRKFVIRLALVGALSFSVISALMPDLYSLSVIRIIVGTFLSAVASLQ 130

  Rat   277 FSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCA 341
            ..:..||.|.:.|...::.......:..:|...:|.||:|: .::..:.|:|....||..::...
  Fly   131 VGFLGEFHAIKWRPITVAICSQSQGLALIYCPLVAMAILPN-NFNVDLSSSYNLRVWRFLMMFFM 194

  Rat   342 FPSVFAIGALTTQPESPRFFLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTIHQEDEL 406
            .|...|:..:...||:|.|.:...:.|:|.:.||.:...|.:.....:...|.....|..||   
  Fly   195 IPGWLALVGICLVPETPHFLMSVNRPDKALLALKWICRMNRKKWEDVDITLSEEKSSTNDQE--- 256

  Rat   407 IEIQSDTGTWYQRW-GVRALSLGGQVWGNFLSCFSPEYRRITLMMMGVWFTMSFSYYGLTVWFPD 470
                   |.|...| ..:.|.....|:..|:..|         ::.|::||.    .||.:||| 
  Fly   257 -------GFWKTVWYEYKLLFSKPHVFKFFICLF---------LIFGIFFTS----IGLGIWFP- 300

  Rat   471 MIRHLQAVDYAARTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECY 535
            :||::                                                            
  Fly   301 VIRNM------------------------------------------------------------ 305

  Rat   536 FEDVTSSNTFFRNCTFINTVFYNTDLFEYKFVNSRLVNSTFLHNKEG-----------CPLDVTG 589
              |.:.||   |.|..:|.                  |.||::::..           |..::|.
  Fly   306 --DNSGSN---RLCDLVNN------------------NPTFINHEADDTNGTDSESPKCNDEMTN 347

  Rat   590 TGEGAYMVYFVSFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSVLSCVSCFFLSFGNSESAMI-- 652
            ..:..|  |..:::|..      |::::|:..:.|..::|...::|.:....|:.....:.::  
  Fly   348 LIDPVY--YGFTYIGCF------ILASVLVHWMTRKYVIALHILISMILGISLNIMKQPTVVLIF 404

  Rat   653 -ALLCLFGGVSIASWNALDVLTVELYPSDKRTTAFGFLNALCKLAAVLGISIFTSFVGITKAAPI 716
             .|:.:..||.|..  |..|| |:..|.:.|..|...:.:|.:...|||.::...|:.:|.....
  Fly   405 FVLMMVLPGVLIPL--ATSVL-VDCLPVNLRGKALCMVRSLARFGGVLGSTMIGLFIRVTCDVTF 466

  Rat   717 LFASAALALGSSLALKLPE 735
            ...:..||:...||:..|:
  Fly   467 NIFNLCLAICVVLAVFQPK 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sv2aNP_476558.2 synapt_SV2 1..742 CDD:130366 119/604 (20%)
Interaction with SYT1 1..57
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..145
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 105/549 (19%)
MFS 23..>208 CDD:119392 41/187 (22%)
MFS 354..>482 CDD:304372 29/136 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724235at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.