DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RacGAP84C and ARHGAP32

DIOPT Version :9

Sequence 1:NP_476704.1 Gene:RacGAP84C / 117503 FlyBaseID:FBgn0045843 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001364953.1 Gene:ARHGAP32 / 9743 HGNCID:17399 Length:2101 Species:Homo sapiens


Alignment Length:164 Identity:46/164 - (28%)
Similarity:80/164 - (48%) Gaps:14/164 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 GC-LSDYAPRVAPMVPALIVHCVTEIEARGLQQEGLYRVSSTREKCKRLRRKLLRGKSTPHLGN- 209
            || |.::.......||.::..|...||..|: .:|:||:|......:|||.: ...:..|.|.. 
Human   385 GCDLGEHLLNSGFEVPQVLQSCTAFIERYGI-VDGIYRLSGVASNIQRLRHE-FDSEHVPDLTKE 447

  Fly   210 ---KDTHTLCCCVKDFLRQLVHPLI--PIYHR-RDFEEATRHEDRLAVEMAVYLAVLELHQAHRD 268
               :|.|::....|.:.|:|.:||:  .:|.: .|...|...|:||   :.::..:.:|...|..
Human   448 PYVQDIHSVGSLCKLYFRELPNPLLTYQLYEKFSDAVSAATDEERL---IKIHDVIQQLPPPHYR 509

  Fly   269 TLAYLMLHWQKIAESPAV-RMTVNNLAVIFAPTL 301
            ||.:||.|...:|:..:: .|...|||:::||.|
Human   510 TLEFLMRHLSLLADYCSITNMHAKNLAIVWAPNL 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RacGAP84CNP_476704.1 C1_1 87..139 CDD:278556
RhoGAP_MgcRacGAP 142..330 CDD:239847 46/164 (28%)
ARHGAP32NP_001364953.1 PX_RICS 141..255 CDD:132831
SH3_ARHGAP32_33 277..330 CDD:212769
RhoGAP_CdGAP 382..576 CDD:239849 46/164 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 832..872
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 941..1052
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1117..1157
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1183..1271
Interaction with GAB2. /evidence=ECO:0000269|PubMed:12819203 1405..1725
Interaction with FYN. /evidence=ECO:0000269|PubMed:12788081 1699..2101
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1812..1910
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.