DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RacGAP84C and arhgap32

DIOPT Version :9

Sequence 1:NP_476704.1 Gene:RacGAP84C / 117503 FlyBaseID:FBgn0045843 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_004916221.2 Gene:arhgap32 / 734056 XenbaseID:XB-GENE-1002474 Length:1995 Species:Xenopus tropicalis


Alignment Length:297 Identity:68/297 - (22%)
Similarity:115/297 - (38%) Gaps:77/297 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FGSQSLDSLQDRV----------------DMNPSG---------CDGLSTDGLDFCSQ--SHSGL 83
            |.|:.::.:.|:|                .|.|:.         .|.| ..|...||:  |||.|
 Frog   315 FPSECVELINDKVPQSMTNSVPKPVSPAHGMRPASWSYFPPYLEMDSL-RPGTSCCSEVLSHSQL 378

  Fly    84 ---LREHNFKIKSYYYNVGNCVHCRKRIRFAMASLRCRACPLRCHI---GCCRQLTVNCIPQPQI 142
               .|:|.                 |.|.|....::.|  |.:..:   |..|:....|      
 Frog   379 SSVSRKHG-----------------KLITFLRTFMKSR--PSKQKLKQRGILRERVFGC------ 418

  Fly   143 GTKRGCLSDYAPRVAPMVPALIVHCVTEIEARGLQQEGLYRVSSTREKCKRLRRKLLRGKSTPHL 207
                 .|.::.......||.::..|...||..|: .:|:||:|......::||.: ...:..|.|
 Frog   419 -----DLGEHLLNSGQDVPQVLRSCTEFIEKHGI-VDGIYRLSGIASNIQKLRHE-FDSEQIPDL 476

  Fly   208 GN----KDTHTLCCCVKDFLRQLVHPLI--PIYHR-RDFEEATRHEDRLAVEMAVYLAVLELHQA 265
            ..    :|.|.:....|.:.|:|.:||:  .:|.: .|...|...|:||   :.::..:.:|...
 Frog   477 TKDVYIQDIHCVGSLCKLYFRELPNPLLTYQLYEKFSDAVSAATDEERL---VKIHDVIQQLPPP 538

  Fly   266 HRDTLAYLMLHWQKIAESPAV-RMTVNNLAVIFAPTL 301
            |..||.:||.|..::|...:: .|...|||:::||.|
 Frog   539 HYRTLEFLMRHLSRLATYCSITNMHTKNLAIVWAPNL 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RacGAP84CNP_476704.1 C1_1 87..139 CDD:278556 9/54 (17%)
RhoGAP_MgcRacGAP 142..330 CDD:239847 43/168 (26%)
arhgap32XP_004916221.2 PX_RICS 131..245 CDD:132831
SH3_ARHGAP32_33 267..320 CDD:212769 2/4 (50%)
RhoGAP_CdGAP 414..608 CDD:239849 44/178 (25%)
ZipA <1758..>1898 CDD:225657
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.