DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RacGAP84C and racgap1.2

DIOPT Version :9

Sequence 1:NP_476704.1 Gene:RacGAP84C / 117503 FlyBaseID:FBgn0045843 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_031748578.1 Gene:racgap1.2 / 733574 XenbaseID:XB-GENE-5952945 Length:594 Species:Xenopus tropicalis


Alignment Length:310 Identity:97/310 - (31%)
Similarity:149/310 - (48%) Gaps:39/310 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 SQSLDSLQDRV-----------DMNPSGCDGLSTDGLDFCSQSHSGLLREHNFKIKSYYYNVGNC 101
            |:.|.||||:.           :|.|        :...:.:::|..|.|.   .|::..     |
 Frog   240 SRPLSSLQDQTPALPQINEEEKEMEP--------EPPPYPTRTHVYLSRT---MIRAEL-----C 288

  Fly   102 VHCRKRIRFAMASLRCRACPLRCHIGC---CRQLTVNCIPQPQIGTKR--GCLSDYAPRVAPMVP 161
            :.|.:::||....|:|:.|.:..|..|   |.::..:.:|......|.  |.|:||||...|.||
 Frog   289 MVCGQKVRFGKMCLKCKDCRILIHPECKDFCPKVCSSALPSHSTNPKNGPGVLADYAPAAPPRVP 353

  Fly   162 ALIVHCVTEIEARGLQQEGLYRVSSTREKCKRLRRKLLRGK-STPHLGNKDTHTLCCCVKDFLRQ 225
            :.:|.||.|||.||..:.|:||:.......|.|::|||:|| ...||..:|.||:|..:|:|.|.
 Frog   354 SQVVQCVNEIEKRGFSERGIYRIPGCDRLVKELKQKLLQGKIKAQHLAKEDVHTVCGALKEFFRT 418

  Fly   226 LVHPLIPIYHRRDFEEATRHEDRLAVEMAVYLAVLELHQAHRDTLAYLMLHWQKIAESPAVRMTV 290
            |..||:.......|.:|....|..........||.:|...:|||||:|:||..::..||..:|..
 Frog   419 LQEPLLTYSLHATFLDAADILDECDGRAETCQAVHDLPAPNRDTLAFLILHLYRVMRSPECKMDK 483

  Fly   291 NNLAVIFAPTLFG------DLDLTLENVVTWQRVLKVLLLMPAGFWSQFL 334
            .||:.||.|||.|      ...:.:::.....:|:.:||.:|..||.|||
 Frog   484 TNLSRIFGPTLVGYSVPNPSPLMIMQDTPRQAKVMSMLLSIPCAFWDQFL 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RacGAP84CNP_476704.1 C1_1 87..139 CDD:278556 11/54 (20%)
RhoGAP_MgcRacGAP 142..330 CDD:239847 69/196 (35%)
racgap1.2XP_031748578.1 C1_MgcRacGAP 273..323 CDD:410371 14/57 (25%)
RhoGAP_MgcRacGAP 336..529 CDD:239847 68/192 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 140 1.000 Domainoid score I4716
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D184774at33208
OrthoFinder 1 1.000 - - FOG0004815
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3396
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.