DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RacGAP84C and Chn2

DIOPT Version :9

Sequence 1:NP_476704.1 Gene:RacGAP84C / 117503 FlyBaseID:FBgn0045843 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001157112.1 Gene:Chn2 / 69993 MGIID:1917243 Length:468 Species:Mus musculus


Alignment Length:264 Identity:74/264 - (28%)
Similarity:125/264 - (47%) Gaps:23/264 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 SQSHSGLLREHNFKIKSY---YYNVGNCVHCRKRIRFAMA-SLRCRACPLRCHIGCCRQLTVNCI 137
            :.:|....:.||||:.::   ::    |.:|...:...:| .:||..|.|..|..|.:.:..:|.
Mouse   205 NDNHFNYEKTHNFKVHTFRGPHW----CEYCANFMWGLIAQGVRCSDCGLNVHKQCSKHVPNDCQ 265

  Fly   138 PQPQIGTKRGC--LSDYAPRVAPMVPALIVHCVTEIEARGLQQEGLYRVSSTREKCKRLRRKLLR 200
            |..:...|..|  |:..........|.::..|:.|||||||:.|||||||...|..:.::....|
Mouse   266 PDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDR 330

  Fly   201 -GKSTPHLGN--KDTHTLCCCVKDFLRQLVHPLIPIYHRRDFEEATR---HEDRLAVEMAVYLAV 259
             |:......|  .|.:.:...:|.:.|.|..|:|.......|.||.:   .::||.   ||:..:
Mouse   331 DGEKADISANIYPDINIITGALKLYFRDLPIPIITYDTYSKFIEAAKISNADERLE---AVHEVL 392

  Fly   260 LELHQAHRDTLAYLMLHWQKIAESPAVR-MTVNNLAVIFAPTLF---GDLDLTLENVVTWQRVLK 320
            :.|..||.:||.|||:|.:|:..:.... |...||.::|.|||.   .|..||..:.:.:|:::.
Mouse   393 MLLPPAHYETLRYLMIHLKKVTMNEKDNLMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIV 457

  Fly   321 VLLL 324
            .:|:
Mouse   458 QILI 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RacGAP84CNP_476704.1 C1_1 87..139 CDD:278556 14/55 (25%)
RhoGAP_MgcRacGAP 142..330 CDD:239847 58/195 (30%)
Chn2NP_001157112.1 SH2_a2chimerin_b2chimerin 52..138 CDD:198215
C1_1 215..267 CDD:278556 14/55 (25%)
RhoGAP_chimaerin 275..468 CDD:239837 57/190 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.