DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RacGAP84C and si:ch1073-416j23.1

DIOPT Version :9

Sequence 1:NP_476704.1 Gene:RacGAP84C / 117503 FlyBaseID:FBgn0045843 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_695377.7 Gene:si:ch1073-416j23.1 / 553480 ZFINID:ZDB-GENE-100922-35 Length:671 Species:Danio rerio


Alignment Length:280 Identity:102/280 - (36%)
Similarity:144/280 - (51%) Gaps:25/280 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 EHNFKIKSYYYNVGNCVHCRKRIRFAMASLRCRACPLRCHIGCCRQLTVNCIP------QPQIGT 144
            :|.|:.|: ......|:.|.|||||...:::||.|.:..|..|.|.....|.|      .|...|
Zfish   335 QHVFQQKT-VIRPETCLPCGKRIRFGKLAVKCRDCRVVSHPECKRLCPERCSPNAHGSSHPNEET 398

  Fly   145 KRGCLSDYAPRVAPMVPALIVHCVTEIEARGLQQEGLYRVSSTREKCKRLRRKLLRGKSTPHLGN 209
                |..:||...|.:|::||.||.|||.|||:::|:|||.....:.|.||.|.|.||....|..
Zfish   399 ----LESFAPSTRPRIPSIIVQCVHEIERRGLEEKGIYRVPGGERQVKELREKYLYGKGPLMLHK 459

  Fly   210 KD-THTLCCCVKDFLRQLVHPLIPIYHRRDFEEATRHEDRLAVEMAVYLAVLELHQAHRDTLAYL 273
            .| .|.:|..:|||||:|..|||.....|.|.||:...|.......:...:.||.|.:|||||:|
Zfish   460 VDEVHAVCGLLKDFLRKLSEPLITFKLHRTFMEASEMADEDKSVETLLKTIRELPQPNRDTLAFL 524

  Fly   274 MLHWQKIAESPAVRMTVNNLAVIFAPTLFGDL-----DLT-LENVVTWQRVLKVLLLMPAGFWSQ 332
            |||.|::.:||..:|.:|||:.:|.||:.|..     .:| :.:..|..||:..||..|:.||..
Zfish   525 MLHLQRVMQSPLCQMDLNNLSRVFGPTIIGHAMSEPSPMTIMRDTNTQPRVVARLLSFPSDFWEG 589

  Fly   333 FL-----EVHP--LPTSLGS 345
            ||     .|:|  :.|::.|
Zfish   590 FLAEENDPVNPPVIETNIAS 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RacGAP84CNP_476704.1 C1_1 87..139 CDD:278556 18/57 (32%)
RhoGAP_MgcRacGAP 142..330 CDD:239847 75/194 (39%)
si:ch1073-416j23.1XP_695377.7 C1 336..384 CDD:237996 16/48 (33%)
RhoGAP_MgcRacGAP 402..587 CDD:239847 73/184 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4591
eggNOG 1 0.900 - - E1_KOG3564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D184774at33208
OrthoFinder 1 1.000 - - FOG0004815
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3396
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.