DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RacGAP84C and racgap1

DIOPT Version :9

Sequence 1:NP_476704.1 Gene:RacGAP84C / 117503 FlyBaseID:FBgn0045843 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001001236.1 Gene:racgap1 / 407917 XenbaseID:XB-GENE-943983 Length:629 Species:Xenopus tropicalis


Alignment Length:275 Identity:115/275 - (41%)
Similarity:157/275 - (57%) Gaps:15/275 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 DFCSQSHSGLLREHNFKIKSYYYNVGNCVHCRKRIRFAMASLRCRACPLRCHIGCCRQLTVNCIP 138
            |.|....:|.:|.|.|..|: .....:||.|.|||:|...||:||.|.:..|..|..:..:.|||
 Frog   273 DTCRTPQNGGMRLHEFVSKT-VIKPESCVPCGKRIKFGKISLKCRDCRVVAHPECRERCPLPCIP 336

  Fly   139 -----QPQIGTKRGCLSDYAPRVAPMVPALIVHCVTEIEARGLQQEGLYRVSSTREKCKRLRRKL 198
                 ..:||  .|.|:|:||..:||:|.:|||||:||:.|||.:.||||:|......|.|:.|.
 Frog   337 TVGGTPVRIG--EGTLADFAPLTSPMIPPIIVHCVSEIQQRGLHETGLYRISGCDRTVKELKEKF 399

  Fly   199 LRGKSTPHLGN-KDTHTLCCCVKDFLRQLVHPLIPIYHRRDFEEATRHEDRLAVEMAVYLAVLEL 262
            |||||.|.|.. .|.|.:|..:|||||.|..||:.....|.|.||....|..:...|:|.||.||
 Frog   400 LRGKSVPLLSKVDDIHAVCGFLKDFLRNLKEPLLTFRLNRVFMEAAEITDEKSSIAAIYQAVDEL 464

  Fly   263 HQAHRDTLAYLMLHWQKIAESPAVRMTVNNLAVIFAPTLFG------DLDLTLENVVTWQRVLKV 321
            ...:||||||||:|.|::|:||..:|.|:||:.:|.|||.|      |....|::......|::.
 Frog   465 PAPNRDTLAYLMIHLQRVAQSPDCKMDVSNLSKVFGPTLVGHAVPDPDPMTILQDTRRQPMVVER 529

  Fly   322 LLLMPAGFWSQFLEV 336
            |:|:||.||:||:.|
 Frog   530 LMLLPAEFWNQFMMV 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RacGAP84CNP_476704.1 C1_1 87..139 CDD:278556 20/56 (36%)
RhoGAP_MgcRacGAP 142..330 CDD:239847 86/194 (44%)
racgap1NP_001001236.1 SbcC <8..107 CDD:223496
C1 286..334 CDD:237996 17/48 (35%)
RhoGAP_MgcRacGAP 345..538 CDD:239847 86/194 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 140 1.000 Domainoid score I4716
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D184774at33208
OrthoFinder 1 1.000 - - FOG0004815
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4412
SonicParanoid 1 1.000 - - X3396
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.040

Return to query results.
Submit another query.