DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RacGAP84C and RhoGAP15B

DIOPT Version :9

Sequence 1:NP_476704.1 Gene:RacGAP84C / 117503 FlyBaseID:FBgn0045843 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_573183.2 Gene:RhoGAP15B / 32686 FlyBaseID:FBgn0030808 Length:1552 Species:Drosophila melanogaster


Alignment Length:434 Identity:79/434 - (18%)
Similarity:135/434 - (31%) Gaps:173/434 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RTPSNRLYLSPVRPTMQNKRRLLREYRSYDDLSEHYR----MFGSQSLDSLQ----DRV------ 58
            |.||.  .:..:...|||::.:|||.:....|.:..:    |....::.:||    .||      
  Fly   852 RFPSG--VVEDILKEMQNRKAILRERQFQTFLDQEMKTPREMIPLDTITTLQCVSNSRVTDTATH 914

  Fly    59 ----------DMNPSGC-DGLSTDGLDFCSQSHSGLLREHN------------------------ 88
                      ..|.:|. |.:|::.....:.|.||.:::..                        
  Fly   915 FYCFEITTSQPKNGNGAGDAMSSNPNLLMTSSSSGNVKQQRVSHLYGVGKESERGVWMQKILESL 979

  Fly    89 -----FKIKSYYYNVGNCV-----------------HCRKRIRFAMAS--------LRCRACPL- 122
                 .|...:||..|.|.                 ..::|:.|...:        ||...|.: 
  Fly   980 TNSLPVKYTCHYYRAGWCYLKNSITSEWSGTWLVLRKSQRRLIFVSEANGNVEKMDLRKARCIVL 1044

  Fly   123 --------RCHIGCCRQLTVNCIPQP---------------------------QIGTKRGCLSDY 152
                    ..|:.....|.::|.|..                           .:|.::  |:.|
  Fly  1045 KESDESIDNLHVESGPMLMIDCPPYAVYMIMSSARETKIWRHIIREVAHNNGFSLGDQQ--LTRY 1107

  Fly   153 APRVAPMVPALIVHCVTEIEARGLQQEGLYRVSSTREKCKRL----RRKLLRGKSTPHLGNKDTH 213
            .      ||.::..|:..:...|...||:||.|.:.....:|    |......:.|.:..|:  |
  Fly  1108 D------VPVIVDKCINFVYIHGSMSEGIYRKSGSENSMHKLMSAFRADAFNVEITRNEYNE--H 1164

  Fly   214 TLCCCVKDFLRQLVHPL--------------------IPIYHRRDFEEATRHEDRLAVEMAVYLA 258
            .:...:|.|:|.|...|                    ||||.                |:...|:
  Fly  1165 DVANVLKRFMRDLPERLLGKLTDSFVFVTELAVASEKIPIYR----------------ELLARLS 1213

  Fly   259 VLELHQAHRDTLAYLMLHWQKIAESPAV-RMTVNNLAVIFAPTL 301
            .:|     |:||..::.|...|:...|. :|:|.||.:|:.|||
  Fly  1214 AIE-----RETLRRIVGHLVFISSQQAKNKMSVQNLTMIWGPTL 1252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RacGAP84CNP_476704.1 C1_1 87..139 CDD:278556 13/114 (11%)
RhoGAP_MgcRacGAP 142..330 CDD:239847 43/185 (23%)
RhoGAP15BNP_573183.2 RhoGAP_ARAP 1095..1277 CDD:239850 43/189 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448732
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.