DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RacGAP84C and racgap1

DIOPT Version :9

Sequence 1:NP_476704.1 Gene:RacGAP84C / 117503 FlyBaseID:FBgn0045843 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_955925.1 Gene:racgap1 / 323197 ZFINID:ZDB-GENE-030131-1917 Length:654 Species:Danio rerio


Alignment Length:315 Identity:114/315 - (36%)
Similarity:165/315 - (52%) Gaps:29/315 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EYRSYD-DLSEHYRMFGSQSLDSLQDRVDMNPSGCDGLSTDGLDFCSQSHSGLLREHNFKIKSYY 95
            |:.:.| |..:...:|...||.:.::|.:  ||...|             :|.:|.|.| |....
Zfish   269 EWDTVDTDSVQSMDVFKQPSLPNAENRAE--PSTPQG-------------NGGVRLHEF-ISKTV 317

  Fly    96 YNVGNCVHCRKRIRFAMASLRCRACPLRCHIGCCRQLTVNCIPQPQIGTK----RGCLSDYAPRV 156
            ....:||.|.|||:|...||:||.|.:..|..|..:..:.|||. ..||.    .|.|::|....
Zfish   318 IKPESCVPCGKRIKFGKISLKCRDCRVVAHPECRERCPLPCIPS-MTGTPVKIGEGTLANYVSNT 381

  Fly   157 APMVPALIVHCVTEIEARGLQQEGLYRVSSTREKCKRLRRKLLRGKSTPHLGN-KDTHTLCCCVK 220
            :||:|:|:|||:.|||.|||.:.||||||.:....|.|:.|.||||:.|.|.. :|.|.:...:|
Zfish   382 SPMIPSLVVHCINEIEQRGLHETGLYRVSGSDRVVKDLKEKFLRGKTVPLLSKVEDIHAITGLLK 446

  Fly   221 DFLRQLVHPLIPIYHRRDFEEATRHEDRLAVEMAVYLAVLELHQAHRDTLAYLMLHWQKIAESPA 285
            ||||.|..||:.....|.|.:|....|.......:|..:.:|.|.||||||:|::|.|::|:|||
Zfish   447 DFLRNLKEPLLTFRLNRAFMDAAELSDDDNSIALMYQNISDLPQPHRDTLAFLIIHLQRVAQSPA 511

  Fly   286 VRMTVNNLAVIFAPTLFGDLDLTLENVVTWQ------RVLKVLLLMPAGFWSQFL 334
            .:|.:.|||.:|.||:.|......|.:...|      ||::.||.:|..:||||:
Zfish   512 TKMDITNLARVFGPTIVGHAVSNPEPMTILQDTKRQPRVVERLLSLPVEYWSQFM 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RacGAP84CNP_476704.1 C1_1 87..139 CDD:278556 19/51 (37%)
RhoGAP_MgcRacGAP 142..330 CDD:239847 78/198 (39%)
racgap1NP_955925.1 C1 310..358 CDD:237996 17/48 (35%)
RhoGAP_MgcRacGAP 369..562 CDD:239847 76/192 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4591
eggNOG 1 0.900 - - E1_KOG3564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D184774at33208
OrthoFinder 1 1.000 - - FOG0004815
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4412
SonicParanoid 1 1.000 - - X3396
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.